PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019828m
Common NameCICLE_v10019828mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 499aa    MW: 53382.1 Da    PI: 7.0647
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019828mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC758.1e-24206249144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+ep+rCrRtDGKkWRCsr+v + +k+CErH h++r rsrk++e
  Ciclev10019828m 206 DPEPWRCRRTDGKKWRCSRDVAPEQKYCERHSHKSRPRSRKPVE 249
                      79***************************************987 PP

2QLQ56.96.1e-20139174237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      aFTaaQlq+L++Q l+yKy++a++P+P+eLl++i+k
  Ciclev10019828m 139 AFTAAQLQELERQTLIYKYMMASAPIPHELLLPITK 174
                      7*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-10138174IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-14139172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.754139174IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.826206250IPR014977WRC domain
PfamPF088794.5E-19207249IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MQESSSCSRS CSCTTSTSSS SSSAVNYDIN NNNNYQSPQL LLSSSSTSCE ILTAGGGASG  60
CGGSILCNAS NQVACMSDIY DVVGAASRSG TNSAAAVLAS KSLSPPSITD SFFHFNSSAS  120
ASASGEMAAA AAAVNLRLAF TAAQLQELER QTLIYKYMMA SAPIPHELLL PITKSPSTSR  180
VLPSCQPNMV QGSMELRLLS NNSSSDPEPW RCRRTDGKKW RCSRDVAPEQ KYCERHSHKS  240
RPRSRKPVEL PAHRGHNSSL HQSVHNSTLN KSYPKYMASS IALSEQQEQP RSLEWFMKGE  300
TMPVASNSNQ EWLQNTSKYG GHHHHHKEHL INSNNLSGDD LAFDAQRLHD QYSLLLSPKM  360
VSHHAQQTQE TRHFIDAWSL GLGGENMADE DGMGSTSNCF VSSNEKLPLS SLTLSMSGGN  420
ETIERNENAL MASLGTMGSE RENAGALRPH WMNHVSGMGS PPGGPLAEVL CLGTASSVKS  480
DSNAASPHGC STSTTTSS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.21840.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1085415e-52DQ108541.1 Corchorus olitorius SSR marker J142-M13F genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439212.10.0hypothetical protein CICLE_v10019828mg
TrEMBLV4TGH00.0V4TGH0_9R
STRINGPOPTR_0001s11480.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78362637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.11e-30growth-regulating factor 8